Recombinant H. alvei Intimin Protein, His-SUMO-tagged
| Cat.No. : | eaeA-1196H |
| Product Overview : | Recombinant Hafnia alvei Intimin Protein (1-280aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | H.alvei |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-280 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 46.1 kDa |
| AA Sequence : | ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Intimin |
| Official Symbol | Intimin |
| Synonyms | Intimin; Attaching and effacing protein; Outer membrane protein; eaeA; P52869 |
| UniProt ID | P52869 |
| ◆ Recombinant Proteins | ||
| eaeA-1196H | Recombinant H. alvei Intimin Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Intimin Products
Required fields are marked with *
My Review for All Intimin Products
Required fields are marked with *
