Recombinant H. alvei Intimin Protein, His-SUMO-tagged

Cat.No. : eaeA-1196H
Product Overview : Recombinant Hafnia alvei Intimin Protein (1-280aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : H.alvei
Source : E.coli
Tag : His&SUMO
Protein Length : 1-280 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 46.1 kDa
AA Sequence : ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Intimin
Official Symbol Intimin
Synonyms Intimin; Attaching and effacing protein; Outer membrane protein; eaeA; P52869
UniProt ID P52869

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Intimin Products

Required fields are marked with *

My Review for All Intimin Products

Required fields are marked with *

0

Inquiry Basket

cartIcon