Recombinant H. pylori HP0243 Protein, His-SUMO-tagged

• Cat.No.: HP0243-1191H
• Product Overview: Recombinant H. pylori Helicobacter pylori (strain ATCC 700392 / 26695) HP0243 Protein (1-144aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.

Specification

• Species: H.pylori
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-144 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 32.9 kDa
• AA Sequence: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLS
  EAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQ
  AHLA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: HP0243 DNA protection during starvation protein [ Helicobacter pylori 26695 ]
• Official Symbol: HP0243
• Synonyms: Recommended name: DNA protection during starvation protein EC= 1.16.-.- Alternative name(s): Bacterioferritin HP-NAP Neutrophil-activating protein A Short name= NAP A
• Gene ID: 898765
• Protein Refseq: NP_207041.1
• UniProt ID: P43313