Recombinant H. pylori HP0887 Protein, His-tagged

• Cat.No.: HP0887-1399H
• Product Overview: Recombinant H. pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) HP0887 Protein (37-245aa) was expressed in E. coli with N-terminal His tag.

Specification

• Species: H.pylori
• Source: E.coli
• Tag: His
• Protein Length: 37-245 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 26.6 kDa
• AA Sequence: TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLS
  SKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFT
  SYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: HP0887 vacuolating cytotoxin autotransporter [ Helicobacter pylori 26695 ]
• Official Symbol: HP0887; vacuolating cytotoxin autotransporter; vacA; Vacuolating cytotoxin; Vacuolating cytotoxin translocator
• Synonyms: HP0887
• Gene ID: 899415
• Protein Refseq: NP_207680.1
• UniProt ID: P55981