Recombinant H2-K1 protein, His-tagged
Cat.No. : | H2-K1-3172 |
Product Overview : | Recombinant H2-K1 protein(48-262 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | His |
Protein Length : | 48-262 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
◆ Recombinant Proteins | ||
H2-K1-5683M | Recombinant Mouse H2-K1 Protein (Full Length), Avi tagged | +Inquiry |
H2-K1-3172 | Recombinant H2-K1 protein, His-tagged | +Inquiry |
H2-K1-406M | Recombinant Mouse H2-K1 protein, His-tagged | +Inquiry |
H2-K1-4096M | Recombinant Mouse H2-K1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2-K1 Products
Required fields are marked with *
My Review for All H2-K1 Products
Required fields are marked with *