Recombinant Haemophilus influenzae nrfB Protein
| Cat.No. : | nrfB-108H |
| Product Overview : | Recombinant Haemophilus influenzae nrfB Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Haemophilus influenzae |
| Source : | E.coli |
| Description : | Cytochrome c nitrite reductase pentaheme subunit |
| Form : | Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl. |
| Molecular Mass : | ~23.7 kDa |
| AA Sequence : | DDAQKPADHVTYEPQLDNQRDPNQYCAKCHKFDKIDKNQTLDRSGGELHFGKFHGAHLDKKNPNNGKAITCVSCHGNVSENHRRGAKDVMRFEGDIFGNKKPMYSVQEQNQVCFACHQPDKLREKLWAHDVHAMKLPCASCHTLHPKEDAMKGIQPKQRVKLCVDCHGKQQKRKAEQDKLTKQKDKQ |
| Purity : | >85% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 1.1 mg/ml |
| Gene Name | nrfB cytochrome c nitrite reductase pentaheme subunit [ Haemophilus influenzae ] |
| Official Symbol | nrfB |
| Gene ID | 72525693 |
| Protein Refseq | WP_005647730 |
| UniProt ID | P45016 |
| ◆ Recombinant Proteins | ||
| nrfB-108H | Recombinant Haemophilus influenzae nrfB Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All nrfB Products
Required fields are marked with *
My Review for All nrfB Products
Required fields are marked with *
Recently Viewed
