Recombinant Haemophilus influenzae tolA Protein

Cat.No. : tolA-47H
Product Overview : Recombinant Haemophilus influenzae tolA Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Haemophilus influenzae
Source : E.coli
Description : cell envelope integrity protein TolA
Form : Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
Molecular Mass : ~42 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMHTVEIMGGGEGEGDVIGAVIVDTGTAAQEWGRIQQQKKGQADKQKRPEPVVEEKPPEPNQEEIKHQQEVQRQEEIKHQQEVQRQEELKRQQEQQRQQEIKKQQEQARQEALEKQKQAEEARAKQAAEAAKLKADAEAKRLAAAAKQAEEEAKAKAAEIAAQKAKQEAETKAKLEAEAKAKAAAEAKAKAEAEAKAKAAAEAKAKAEAEAKAKAAAEAKAKADAEAKAKAAAEAKAAAEAKRKADQASLDDFFNGGDVGGGSASKGGNTNKGGTQGSGAALGSGDGGKVGDQYAGVIKKEIQRRFLKDPNFAGKVCRIKIQLGRDGTILGYQKISGSDDICSAALSAVARTKKVPAAPSDEIYEKYKSPIIDFDIR
Purity : >85%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.6 mg/ml
Gene Name tolA cell envelope integrity protein TolA [ Haemophilus influenzae ]
Official Symbol tolA
Gene ID 72526505
Protein Refseq WP_042594821
UniProt ID P44678

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All tolA Products

Required fields are marked with *

My Review for All tolA Products

Required fields are marked with *

0
cart-icon
0
compare icon