Recombinant Hamadryas baboon SPACA3 protein, His&Myc-tagged
Cat.No. : | SPACA3-786H |
Product Overview : | Recombinant Hamadryas baboon SPACA3 protein(B6VH79)(87-166aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hamadryas baboon |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 87-166aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KVYSRCELARVLQDFGLDGYRGYSLADWVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCS |
◆ Recombinant Proteins | ||
SPACA3-786H | Recombinant Hamadryas baboon SPACA3 protein, His&Myc-tagged | +Inquiry |
SPACA3-527H | Recombinant Human SPACA3 protein, MYC/DDK-tagged | +Inquiry |
SPACA3-526H | Recombinant Human SPACA3 protein, GST-tagged | +Inquiry |
SPACA3-3367HFL | Recombinant Full Length Human SPACA3 protein, Flag-tagged | +Inquiry |
Spaca3-6065M | Recombinant Mouse Spaca3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPACA3-1678HCL | Recombinant Human SPACA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPACA3 Products
Required fields are marked with *
My Review for All SPACA3 Products
Required fields are marked with *