Recombinant HBsAg
| Cat.No. : | HBsAg-271H |
| Product Overview : | The E.coli derivedRecombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids & having a molecular weight of 5.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HBV |
| Source : | E.coli |
| Tag : | Non |
| Description : | Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2. |
| Form : | HBsAg protein was lyophilized from 0.2μm filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl. |
| Molecular Mass : | 5.7 kDa |
| AA Sequence : | MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN. |
| Purity : | HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining). |
| Applications : | 1. Immunochromatography (capture and conjugate).2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2. 3. ELISA. |
| Storage : | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted prepa |
| Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
| ◆ Recombinant Proteins | ||
| HBsAg-262H | Recombinant HBsAg | +Inquiry |
| HBsAg-253H | Recombinant HBsAg | +Inquiry |
| HBsAg-259H | Recombinant HBsAg | +Inquiry |
| HBsAg L-14V | Recombinant Hepatitis B virus HBsAg L-protein genotype C Protein | +Inquiry |
| HBsAg-257H | Recombinant HBsAg | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All HBsAg Products
Required fields are marked with *
My Review for All HBsAg Products
Required fields are marked with *

