Recombinant HBV HBsAg protein
| Cat.No. : | HBsAg-254H |
| Product Overview : | Recombinant HBV HBsAg(Met 1 - Ile 227) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HBV |
| Source : | Yeast |
| Tag : | Non |
| Protein Length : | Met 1 - Ile 227 |
| Description : | Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. At the center of the hepatitis B virus is DNA, which contains the genes the virus uses to replicate itself. Surrounding the DNA is a protein called HBcAg (hepatitis B core antigen), which cannot be detected with blood tests. Surrounding this is HBsAg, which is actually part of the protective "envelope." This envelope surrounds the virus and protects it from attack by the body's immune system. HBsAg stands for hepatitis B surface antigen and is the surface antigen of the Hepatitis-B-Virus (HBV) S-gene. The capsid of a virus has different surface proteins from the rest of the virus. The antigen is a protein that binds specifically on one of these surface proteins. It is commonly referred to as the Australian Antigen. |
| Predicted N Terminal : | Met |
| Form : | Lyophilized from 0.22 μm filtered solution in 6.2 mM Phosphate, 200 mM NaCl bufer, pH 7.2. Normally Mannitol or Trehalose are added as protectants before lyophilization. |
| Molecular Mass : | Has a calculated MW of 24 kDa. The reducing (R) protein migrates as 24 kDa in SDS-PAGE. |
| AA Sequence : | MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVL LDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPT VWLSA IWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI |
| Endotoxin : | Less than 0.05 EU per μg by the LAL method. |
| Purity : | >97% as determined by SDS-PAGE. |
| Storage : | Avoid repeated freeze-thaw cycles. No activity loss was observed after storage at: In lyophilized state for 1 year (4 centigrade); After reconstitution under sterile conditions for 3 months (-70 centigrade). |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBsAg Products
Required fields are marked with *
My Review for All HBsAg Products
Required fields are marked with *



