Recombinant Helicobacter pylori Catalase (AA 1-505), C-GFP/His-Tagged
Cat.No. : | Catalase-74H |
Product Overview : | Recombinant Helicobacter pylori Catalase (AA 1-505) with C-GFP/His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter pylori |
Source : | E.coli |
Tag : | GFP&His |
Protein Length : | AA 1-505 |
Description : | Catalases are conserved and abundant enzymes found in all domains of life. They protect against oxidative stress and are highly expressed. In the gastric pathogen Helicobacter pylori, KatA levels are estimated to be up to 4-5% of the total protein content. The presence of the enzyme is ubiquitous, it could be detected in the cytoplasm, the periplasm and on the cell surface as well as being readily detected extracellularly. The enzyme is described to use heme as cofactor. |
Form : | Liquid |
AA Sequence : | MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTEEGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPDSNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELNKNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPRCPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRADDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVKKALEKHQKMMKDMHGKDMHHTKKKK |
Purity : | > 75% as determined by SDS-PAGE |
Storage : | Stored and shipped at -80 centigrade |
Storage Buffer : | PBS, pH 7.4 |
Official Symbol | Catalase |
Synonyms | Catalase; KatA; EC:1.11.1.6 |
Protein Refseq | NP_207669 |
UniProt ID | P77872 |
◆ Recombinant Proteins | ||
Catalase-1608 | Recombinant Catalase Protein (M1-A483), Flag/His-tagged | +Inquiry |
Catalase-1607B | Recombinant Bacillus Catalase Protein (M1-A483) | +Inquiry |
Catalase-74H | Recombinant Helicobacter pylori Catalase (AA 1-505), C-GFP/His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Catalase Products
Required fields are marked with *
My Review for All Catalase Products
Required fields are marked with *