Recombinant Helicobacter pylori Catalase (AA 1-505), C-GFP/His-Tagged

Cat.No. : Catalase-74H
Product Overview : Recombinant Helicobacter pylori Catalase (AA 1-505) with C-GFP/His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Helicobacter pylori
Source : E.coli
Tag : GFP&His
Protein Length : AA 1-505
Description : Catalases are conserved and abundant enzymes found in all domains of life. They protect against oxidative stress and are highly expressed. In the gastric pathogen Helicobacter pylori, KatA levels are estimated to be up to 4-5% of the total protein content. The presence of the enzyme is ubiquitous, it could be detected in the cytoplasm, the periplasm and on the cell surface as well as being readily detected extracellularly. The enzyme is described to use heme as cofactor.
Form : Liquid
AA Sequence : MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTEEGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPDSNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLQDYPLMEVGIVELNKNPENYFAEVEQAAFSPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPRCPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRADDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVKKALEKHQKMMKDMHGKDMHHTKKKK
Purity : > 75% as determined by SDS-PAGE
Storage : Stored and shipped at -80 centigrade
Storage Buffer : PBS, pH 7.4
Official Symbol Catalase
Synonyms Catalase; KatA; EC:1.11.1.6
Protein Refseq NP_207669
UniProt ID P77872

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Catalase Products

Required fields are marked with *

My Review for All Catalase Products

Required fields are marked with *

0
cart-icon
0
compare icon