Recombinant Helicobacter Pylori UREA Protein (1-238 aa), His-tagged
| Cat.No. : | UREA-1579H |
| Product Overview : | Recombinant Helicobacter Pylori (strain ATCC 700392/26695) (Campylobacter pylori) UREA Protein (1-238 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Helicobacter Pylori |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-238 aa |
| Description : | Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 28.5 kDa |
| AA Sequence : | MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Synonyms | ureA; Urea amidohydrolase subunit alpha; |
| UniProt ID | P14916 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UREA Products
Required fields are marked with *
My Review for All UREA Products
Required fields are marked with *
