Recombinant Hepatitis B virus X Protein
Cat.No. : | HBx-3258V |
Product Overview : | Hepatitis B Virus Protein X is a 17.8kDa protein containing 165 amino acid residues and purified by proprietary chromatographic techniques. |
Availability | July 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | HBV |
Source : | E.coli |
Tag : | His |
Form : | Filtered (0.4µm) and lyophilized from 0.5mg/ml in 50mM acetate buffer pH4 and 5% trehalose. |
Molecular Mass : | 17.8kDa |
AA Sequence : | MRGSHHHHHHGSAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA |
Purity : | Greater than 90% |
Storage : | For long term storage lyophilized protein should be stored at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade. |
Reconstitution : | It is recommended to add 0.1M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 µg/ml. In higher concentrations the solubility of the HBV X antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture. |
◆ Recombinant Proteins | ||
HBx-3258V | Recombinant Hepatitis B virus X Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBx Products
Required fields are marked with *
My Review for All HBx Products
Required fields are marked with *