Recombinant Hepatitis B virus X Protein

Cat.No. : HBx-3258V
Product Overview : Hepatitis B Virus Protein X is a 17.8kDa protein containing 165 amino acid residues and purified by proprietary chromatographic techniques.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HBV
Source : E.coli
Tag : His
Form : Filtered (0.4µm) and lyophilized from 0.5mg/ml in 50mM acetate buffer pH4 and 5% trehalose.
Molecular Mass : 17.8kDa
AA Sequence : MRGSHHHHHHGSAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
Purity : Greater than 90%
Storage : For long term storage lyophilized protein should be stored at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade.
Reconstitution : It is recommended to add 0.1M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 µg/ml. In higher concentrations the solubility of the HBV X antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBx Products

Required fields are marked with *

My Review for All HBx Products

Required fields are marked with *

0

Inquiry Basket

cartIcon