Recombinant HER2/neu (478-584)

Cat.No. : ERBB2-01
Availability September 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Source : E.coli
Tag : Non
Form : 20mM Tris-HCl, pH8.0, 200mM NaCl
Molecular Mass : (Theoretical molecular weight): ~12kDa
AA Sequence : LCFVHTVPWDQLFRNPHQALLHSGNRPEEDCGLEGLVCNSLCAHGHCWGPGPTQCVNCSH FLRGQECVEECRVWKGLPREYVSDKRCLPCHPECQPQNSSETCFGSE
Purity : >92% as determined by SDS-PAGE
Storage : Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Gene Name erbb2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog [ Xenopus laevis ]
Official Symbol ERBB2
Synonyms ERBB2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; receptor tyrosine kinase ErbB2;
Gene ID 724075
mRNA Refseq NM_001095593
Protein Refseq NP_001089062
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; Focal adhesion, organism-specific biosystem;

STING agonist promotes CAR T cell trafficking and persistence in breast cancer

Journal: The Journal of Experimental Medicine    PubMed ID: 33382402    Data: 2021/2/1

Authors: Nuo Xu, Douglas C. Palmer, Jonathan S. Serody

Article Snippet:Anti-Neu CAR T cells were detected using recombinant Neu/Her2.Fc fusion protein conjugated with PE (Neu-PE; Creative BioMart).. Antibodies used in in vitro assays included anti–CD45-FITC/e450 (30-F11; Invitrogen), anti–IFN-γ-APC (XMG1.2; Invitrogen), anti–TNF-PE-Cy7 (MP6-XT22; Invitrogen), and anti–IL-17A-PE (eBio17B7; Invitrogen).Antibodies used in in vitro assays included anti–CD45-FITC/e450 (30-F11; Invitrogen), anti–IFN-γ-APC (XMG1.2; Invitrogen), anti–TNF-PE-Cy7 (MP6-XT22; Invitrogen), and anti–IL-17A-PE (eBio17B7; Invitrogen).

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Do you have a recommended protocol for immobilizing any avi-tagged recombinant proteins on a streptavidin coated plate? 02/01/2023

1.Prepare the streptavidin-coated plate by washing it with PBS (phosphate-buffered saline) or another suitable buffer to remove any impurities. 2.Dilute the Avi-tagged protein in the desired buffer at the desired concentration. It is important to use a buffer that is compatible with the protein and does not interfere with its activity or stability. 3.Add the diluted protein to the streptavidin-coated plate and incubate it for a suitable amount of time at room temperature or 4°C. The exact conditions will depend on the specific protein and the desired level of immobilization. 4.Wash the plate with a suitable buffer to remove any unbound protein. 5.Block the remaining binding sites on the plate with a suitable blocking agent such as BSA (bovine serum albumin) or casein. 6.Wash the plate again to remove any unbound blocking agent. 7.Use the immobilized protein for further experiments such as ELISA, Western blotting, or other assays.

Ask a Question for All ERBB2 Products

Required fields are marked with *

My Review for All ERBB2 Products

Required fields are marked with *

0
cart-icon