Recombinant HER2/neu (478-584)

Cat.No. : ERBB2-01
Product Overview : Recombinant HER2/neu (478-584aa),was expressed in E. coli without tag.
Availability June 11, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Source : E.coli
Tag : Non
Form : 20mM Tris-HCl, pH8.0, 200mM NaCl
Molecular Mass : (Theoretical molecular weight): ~12kDa
AA Sequence : LCFVHTVPWDQLFRNPHQALLHSGNRPEEDCGLEGLVCNSLCAHGHCWGPGPTQCVNCSH FLRGQECVEECRVWKGLPREYVSDKRCLPCHPECQPQNSSETCFGSE
Purity : >92% as determined by SDS-PAGE
Storage : Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Gene Name erbb2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog [ Xenopus laevis ]
Official Symbol ERBB2
Synonyms ERBB2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; receptor tyrosine kinase ErbB2;
Gene ID 724075
mRNA Refseq NM_001095593
Protein Refseq NP_001089062
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; Focal adhesion, organism-specific biosystem;

STING agonist promotes CAR T cell trafficking and persistence in breast cancer

Journal: The Journal of Experimental Medicine    PubMed ID: 33382402    Data: 2021/2/1

Authors: Nuo Xu, Douglas C. Palmer, Jonathan S. Serody

Article Snippet:Anti-Neu CAR T cells were detected using recombinant Neu/Her2.Fc fusion protein conjugated with PE (Neu-PE; Creative BioMart).. Antibodies used in in vitro assays included anti–CD45-FITC/e450 (30-F11; Invitrogen), anti–IFN-γ-APC (XMG1.2; Invitrogen), anti–TNF-PE-Cy7 (MP6-XT22; Invitrogen), and anti–IL-17A-PE (eBio17B7; Invitrogen).Antibodies used in in vitro assays included anti–CD45-FITC/e450 (30-F11; Invitrogen), anti–IFN-γ-APC (XMG1.2; Invitrogen), anti–TNF-PE-Cy7 (MP6-XT22; Invitrogen), and anti–IL-17A-PE (eBio17B7; Invitrogen).

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERBB2 Products

Required fields are marked with *

My Review for All ERBB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon