Recombinant HER2/neu (478-584)

• Cat.No.: ERBB2-01
• Product Overview: Recombinant HER2/neu (478-584aa),was expressed in E. coli without tag.

Specification

• Source: E.coli
• Tag: Non
• Form: 20mM Tris-HCl, pH8.0, 200mM NaCl
• Molecular Mass: (Theoretical molecular weight): ~12kDa
• AA Sequence: LCFVHTVPWDQLFRNPHQALLHSGNRPEEDCGLEGLVCNSLCAHGHCWGPGPTQCVNCSH FLRGQECVEECRVWKGLPREYVSDKRCLPCHPECQPQNSSETCFGSE
• Purity: >92% as determined by SDS-PAGE
• Storage: Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

Gene Information

• Gene Name: erbb2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog [ Xenopus laevis ]
• Official Symbol: ERBB2
• Synonyms: ERBB2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; receptor tyrosine kinase ErbB2
• Gene ID: 724075
• mRNA Refseq: NM_001095593
• Protein Refseq: NP_001089062
• Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; Focal adhesion, organism-specific biosystem

Citation

STING agonist promotes CAR T cell trafficking and persistence in breast cancer

Journal: The Journal of Experimental Medicine    PubMed ID: 33382402    Data: 2021/2/1

Authors: Nuo Xu, Douglas C. Palmer, Jonathan S. Serody

Article Snippet:Anti-Neu CAR T cells were detected using recombinant Neu/Her2.Fc fusion protein conjugated with PE (Neu-PE; Creative BioMart).. Antibodies used in in vitro assays included anti–CD45-FITC/e450 (30-F11; Invitrogen), anti–IFN-γ-APC (XMG1.2; Invitrogen), anti–TNF-PE-Cy7 (MP6-XT22; Invitrogen), and anti–IL-17A-PE (eBio17B7; Invitrogen).Antibodies used in in vitro assays included anti–CD45-FITC/e450 (30-F11; Invitrogen), anti–IFN-γ-APC (XMG1.2; Invitrogen), anti–TNF-PE-Cy7 (MP6-XT22; Invitrogen), and anti–IL-17A-PE (eBio17B7; Invitrogen).