Recombinant HER2/neu (478-584)
Cat.No. : | ERBB2-01 |
Availability | September 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Source : | E.coli |
Tag : | Non |
Form : | 20mM Tris-HCl, pH8.0, 200mM NaCl |
Molecular Mass : | (Theoretical molecular weight): ~12kDa |
AA Sequence : | LCFVHTVPWDQLFRNPHQALLHSGNRPEEDCGLEGLVCNSLCAHGHCWGPGPTQCVNCSH FLRGQECVEECRVWKGLPREYVSDKRCLPCHPECQPQNSSETCFGSE |
Purity : | >92% as determined by SDS-PAGE |
Storage : | Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. |
Gene Name | erbb2 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog [ Xenopus laevis ] |
Official Symbol | ERBB2 |
Synonyms | ERBB2; v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog; receptor tyrosine kinase ErbB2; |
Gene ID | 724075 |
mRNA Refseq | NM_001095593 |
Protein Refseq | NP_001089062 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem; Focal adhesion, organism-specific biosystem; |
◆ Recombinant Proteins | ||
ERBB2-552HAF488 | Active Recombinant Human ERBB2 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Erbb2-4099RAF647 | Recombinant Rat Erbb2 Protein, None-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Erbb2-4099RAF488 | Recombinant Rat Erbb2 Protein, None-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Erbb2-969M | Recombinant Mouse Erbb2 Protein, MYC/DDK-tagged | +Inquiry |
ERBB2-4113RAF488 | Recombinant Monkey ERBB2 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB2-001CCL | Recombinant Cynomolgus ERBB2 cell lysate | +Inquiry |
ERBB2-2008RCL | Recombinant Rhesus ERBB2 cell lysate | +Inquiry |
ERBB2-2658HCL | Recombinant Human ERBB2 cell lysate | +Inquiry |
ERBB2-465HCL | Recombinant Human ERBB2 cell lysate | +Inquiry |
ERBB2-2010RCL | Recombinant Rat ERBB2 cell lysate | +Inquiry |
STING agonist promotes CAR T cell trafficking and persistence in breast cancer
Journal: The Journal of Experimental Medicine PubMed ID: 33382402 Data: 2021/2/1
Authors: Nuo Xu, Douglas C. Palmer, Jonathan S. Serody
Article Snippet:Anti-Neu CAR T cells were detected using recombinant Neu/Her2.Fc fusion protein conjugated with PE (Neu-PE; Creative BioMart).. Antibodies used in in vitro assays included anti–CD45-FITC/e450 (30-F11; Invitrogen), anti–IFN-γ-APC (XMG1.2; Invitrogen), anti–TNF-PE-Cy7 (MP6-XT22; Invitrogen), and anti–IL-17A-PE (eBio17B7; Invitrogen).Antibodies used in in vitro assays included anti–CD45-FITC/e450 (30-F11; Invitrogen), anti–IFN-γ-APC (XMG1.2; Invitrogen), anti–TNF-PE-Cy7 (MP6-XT22; Invitrogen), and anti–IL-17A-PE (eBio17B7; Invitrogen).
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All ERBB2 Products
Required fields are marked with *
My Review for All ERBB2 Products
Required fields are marked with *