Recombinant HHV-2 UL49 Protein, His-tagged
| Cat.No. : | UL49-1394H |
| Product Overview : | Recombinant HHV-2 UL49 Protein (170-300aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HHV2 |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 170-300 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 17.9 kDa |
| AA Sequence : | GLAKKLHFSTAPPSPTAPWTPRVAGFNKRVFCAAVGRLAATHARLAAVQLWDMSRPHTDEDLNELLDLTT IRVTVCEGKNLLQRANELVNPDAAQDVDATAAARGRPAGRAAATARAPARSASRPRRPLE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | UL49 involved in virion morphogenesis; possibly involved in RNA transport to uninfected cells [ Human herpesvirus 2 ] |
| Official Symbol | UL49 |
| Synonyms | UL49; Tegument protein VP22 |
| Gene ID | 1487336 |
| Protein Refseq | YP_009137201.1 |
| UniProt ID | P89468 |
| ◆ Recombinant Proteins | ||
| UL49-2416H | Recombinant HHV-2 UL49 protein, His-B2M-tagged | +Inquiry |
| UL49-1394H | Recombinant HHV-2 UL49 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UL49 Products
Required fields are marked with *
My Review for All UL49 Products
Required fields are marked with *
