Recombinant HIV-1 gag protein, His-tagged
Cat.No. : | gag-4102H |
Product Overview : | Recombinant HIV-1 gag protein(133-363 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 133-363 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL |
◆ Recombinant Proteins | ||
gag-316H | Recombinant HIV gag, His-tagged | +Inquiry |
gag-727V | Recombinant HIV gag Protein, His-tagged | +Inquiry |
Gag-704M | Recombinant FrMLV Gag Protein, His-tagged | +Inquiry |
gag-023H | Recombinant HIV gag Antigen, His tagged, Biotinylated | +Inquiry |
Gag-1116V | Recombinant HIV-1(group M, subtype C, strain 92BR025) Gag protein(Pro133-Leu363), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All gag Products
Required fields are marked with *
My Review for All gag Products
Required fields are marked with *
0
Inquiry Basket