Recombinant HIV tat protein Clade-B
Cat.No. : | tat-189H |
Product Overview : | HIV-1 TAT Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 86 amino acids encoded by two exons and having chain having a molecular mass of 14kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HIV |
Source : | E.coli |
Tag : | Non |
Protein Length : | 86 amino acids |
Description : | Human immunodeficiency virus type-1 (HIV-1) regulatory Tat protein plays an essential role in viral replication (Jones KA, 1994) and infectivity (Arya SK, 1985; Fisher AG, 1986). In addition, during acute infection, Tat is released extracellularly by infected cells (Chang HC, 1997; Ensoli B, 1990) and is taken up by neighboring cells where it transactivates viral replication (Ensoli B, 1993) and increases virus infectivity. HIV-1 Tat activates transcription of HIV-1 viral genes by inducing phosphorylation of the C-terminal domain (CTD) of RNA polymerase II (RNAPII). Tat can also disturb cellular metabolism by inhibiting proliferation of antigen-specific T lymphocytes and by inducing cellular apoptosis. Tat-induced apoptosis of T-cells is attributed, in part, to the distortion of microtubules polymerization. LIS1 is a microtubule-associated protein that facilitates microtubule polymerization. |
Form : | Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content. Lyophilized with 0.1% glycerol. |
Molecular Mass : | 14kDa |
AA sequence : | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQSRGDPTGPKE. |
Purity : | Greater than 90.0% as determined by SDS-PAGE. |
Usage : | The products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Stability : | Lyophilized HIV-1 TAT although stable at room temperature for 1 week, should be stored desiccated below -18°C. Upon reconstitution HIV-1 TAT should be stored at 4°C between 2-7 days and for future use below -18°C. For long-term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Specificity : | Immunoreactive with all sera of HIV-1 infected individuals. |
Solubility : | It is recommended to reconstitute the lyophilized HIV-1 TAT in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Gene Name | tat p14 [ Human immunodeficiency virus 1 ] |
Official Symbol | tat |
Synonyms | tat; p14 |
Gene ID | 155871 |
Protein Refseq | NP_057853.1 |
UniProt ID | P04608 |
◆ Recombinant Proteins | ||
TAT-5963R | Recombinant Rat TAT Protein | +Inquiry |
Tat-2115M | Recombinant Mouse Tat Protein, His-tagged | +Inquiry |
Tat-6297M | Recombinant Mouse Tat Protein, Myc/DDK-tagged | +Inquiry |
TAT-2157H | Recombinant Human TAT Protein, His (Fc)-Avi-tagged | +Inquiry |
Tat-1041M | Recombinant Mouse Tat protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAT-1238HCL | Recombinant Human TAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tat Products
Required fields are marked with *
My Review for All tat Products
Required fields are marked with *
0
Inquiry Basket