Recombinant Human TAT, GST-tagged

Cat.No. : TAT-2502H
Product Overview : Recombinant Human TAT (1 a.a. - 142 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
Availability July 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible mental retardation. A regulator gene for tyrosine aminotransferase is X-linked.
Molecular Mass : 42.3 kDa
Sequence : MDPYMIQMSSKGNLPSILDVHVNVGGRSSVPGKMKGRKARWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGELGTLLRGCHCPPLLSCSQAGWRRWQLGVSLSTEHGRITSWLLLCFPPIKRGPYCVWKPAYRP
Storagebuffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : TAT
Gene Name TAT tyrosine aminotransferase [ Homo sapiens ]
Synonyms TAT; tyrosine aminotransferase; tyrosine aminotransferase, cytosolic; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5
Gene ID 6898
mRNA Refseq NM_000353
Protein Refseq NP_000344
MIM 613018
UniProt ID P17735
Chromosome Location 16q22.1
Pathway 4-hydroxybenzoate biosynthesis; 4-hydroxyphenylpyruvate biosynthesis; Cysteine and methionine metabolism; FOXA2 and FOXA3 transcription factor networks
Function L-phenylalanine:2-oxoglutarate aminotransferase activity; L-tyrosine:2-oxoglutarate aminotransferase activity; amino acid binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAT Products

Required fields are marked with *

My Review for All TAT Products

Required fields are marked with *

0
cart-icon