Recombinant Human TAT, GST-tagged
Cat.No. : | TAT-2502H |
Product Overview : | Recombinant Human TAT (1 a.a. - 142 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible mental retardation. A regulator gene for tyrosine aminotransferase is X-linked. |
Molecular Mass : | 42.3 kDa |
Sequence : | MDPYMIQMSSKGNLPSILDVHVNVGGRSSVPGKMKGRKARWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGELGTLLRGCHCPPLLSCSQAGWRRWQLGVSLSTEHGRITSWLLLCFPPIKRGPYCVWKPAYRP |
Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | TAT |
Gene Name | TAT tyrosine aminotransferase [ Homo sapiens ] |
Synonyms | TAT; tyrosine aminotransferase; tyrosine aminotransferase, cytosolic; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 |
Gene ID | 6898 |
mRNA Refseq | NM_000353 |
Protein Refseq | NP_000344 |
MIM | 613018 |
UniProt ID | P17735 |
Chromosome Location | 16q22.1 |
Pathway | 4-hydroxybenzoate biosynthesis; 4-hydroxyphenylpyruvate biosynthesis; Cysteine and methionine metabolism; FOXA2 and FOXA3 transcription factor networks |
Function | L-phenylalanine:2-oxoglutarate aminotransferase activity; L-tyrosine:2-oxoglutarate aminotransferase activity; amino acid binding |
◆ Recombinant Proteins | ||
TAT-1709H | Recombinant Human TAT Protein, His-tagged | +Inquiry |
Tat-1041M | Recombinant Mouse Tat protein, His & T7-tagged | +Inquiry |
Tat-6297M | Recombinant Mouse Tat Protein, Myc/DDK-tagged | +Inquiry |
tat-5654H | Recombinant Human immunodeficiency virus 1 tat protein, His-tagged | +Inquiry |
TAT-5963R | Recombinant Rat TAT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAT-1238HCL | Recombinant Human TAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAT Products
Required fields are marked with *
My Review for All TAT Products
Required fields are marked with *