Recombinant HIV1 tat Protein
| Cat.No. : | TAT-01V |
| Product Overview : | Recombinant HIV1 tat Protein was expressed in E.coli. |
| Availability | October 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HIV |
| Source : | E.coli |
| Description : | Tat |
| Form : | 50mM Tris-HCl, 200 mM NaCl, pH 8.0. |
| AA Sequence : | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFMTKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQSRGDPTGPKE |
| Purity : | >95% as determined by SDS-PAGE. |
| Storage : | Store it at 4 centigrade for short term. For long term storage, store it at -20 centigrade~-80 centigrade. |
| Concentration : | 1.0 mg/ml |
| Gene Name | tat Tat [ Human immunodeficiency virus 1 ] |
| Official Symbol | tat |
| Synonyms | HIV1gp5 |
| Gene ID | 155871 |
| Protein Refseq | NP_057853.1 |
| UniProt ID | P04326 |
| ◆ Recombinant Proteins | ||
| TAT-01V | Recombinant HIV1 tat Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIV1gp5 Products
Required fields are marked with *
My Review for All HIV1gp5 Products
Required fields are marked with *
