Recombinant Horse IL1RN protein
Cat.No. : | IL1RN-602H |
Product Overview : | Recombinant Horse IL1RN protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Horse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 152 |
Description : | IL-1RA was initially called the IL-1 inhibitor which is encoded by the IL1RN gene and it is a member of the interleukin 1 cytokine family. It is secreted by various types of cells including immune cells, epithelial cells, and adipocytes. IL-1RA has functions of inhibiting the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. IL-1RA is also used in the treatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role. The equus caballus IL-1RA is a single non-glycosylated polypeptide chain containing 152 amino acids and it has been shown to block the inflammatory responses induced by IL-1 both in vitro and in vivo. The protein shows 26 % amino acid homology to IL-1β and 19 % homology to IL-1α. It also shares 78 %~80 % a.a. sequence identity with murine, rat, porcine IL-1RA. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α-dependent proliferation of murine D10S cells is less than 3.0 μg/ml, corresponding to a specific activity of > 333 IU/mg in the presence of 50 pg/ml rHuIL-1α. |
Molecular Mass : | Approximately 17.4 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. |
AA Sequence : | HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ |
Endotoxin : | Less than 1 EU/µg of rEqIL-1RA as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL1RN |
Official Symbol | IL1RN |
Synonyms | IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; IRAP; IL-1RN; IL1 inhibitor; interleukin-1 receptor antagonist secretory form; IL-1RA; |
Gene ID | 100034236 |
mRNA Refseq | NM_001082525 |
Protein Refseq | NP_001075994 |
UniProt ID | O18999 |
◆ Recombinant Proteins | ||
IL1RN-1893HFL | Recombinant Full Length Human IL1RN Protein, C-Flag-tagged | +Inquiry |
Il1rn-231M | Recombinant Mouse Interleukin-1 Receptor Antagonist | +Inquiry |
IL1RN-248C | Recombinant Cattle IL1RN Protein, His-tagged | +Inquiry |
IL1RN-4645C | Recombinant Chicken IL1RN | +Inquiry |
IL1RN-1171H | Recombinant Human IL1RN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket