Recombinant Horse MMP9 protein

• Cat.No.: MMP9-6754H
• Product Overview: Recombinant Horse MMP9 protein(F7AGL5)(20-640aa) was expressed in Yeast.

Specification

• Species: Horse
• Source: Yeast
• Tag: Non
• Protein Length: 20-640aa
• Tag: Non
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 69.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: APTRHQPTVVVFPGDLLTNLTDRELAEEYLFRYGYTGVAEMSEGDQPLERALRRLQKRLALPETGELDSTTLEAMRTPRCGVPDVGQFQTFEGDLKWHHRDITYWIQNYSGDLPRDVIDDAFARAFAVWSEVTPLTFTRVNGPQADIVIQFGVREHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGPVVPTHFGNADGAPCHFPFTFEGRSYSSCTTDGRSDDMLWCSTTADYDTDRRFGFCPSEKLYTQDGNADGKPCVFPFTFEGRSYSTCTTDGRSDGYRWCATTANYDQDKRYGFCPTRVDSTVNGGNSAGELCVFPFTFLGKEYSACTREGRSDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPAALMYPMYSFTEEPPLHEDDVNGIQYLYGPRPKPEPQPPTTTTLEPQTTVCATGPPTTRPSERPTAGPTGPPSAGPTGPPSAGPPTNPPTAGPSTAPTVPLGPGEEVCNVDIFDAIAEIGNHLHFFKDGRYWRLLEGKGRGVQGPFLIRDTWPMLPPKLDSAFEEPLTKKIFFFSGRQVWVYTGKSALGPRRLDKLGLGADVAQITGALPRGGGKVLLFSRRRFW

Gene Information

• Gene Name: MMP9 matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) [ Equus caballus ]
• Official Symbol: MMP9
• Synonyms: MMP9; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); matrix metalloproteinase-9; matrix metalloproteinase 9
• Gene ID: 100056599
• mRNA Refseq: NM_001111302
• Protein Refseq: NP_001104772