Recombinant Human PRL Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PRL-6262H |
| Product Overview : | PRL MS Standard C13 and N15-labeled recombinant protein (NP_000939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. |
| Molecular Mass : | 25.9 kDa |
| AA Sequence : | MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PRL prolactin [ Homo sapiens (human) ] |
| Official Symbol | PRL |
| Synonyms | PRL; prolactin; GHA1; prolactin; decidual prolactin; growth hormone A1 |
| Gene ID | 5617 |
| mRNA Refseq | NM_000948 |
| Protein Refseq | NP_000939 |
| MIM | 176760 |
| UniProt ID | P01236 |
| ◆ Recombinant Proteins | ||
| PRL-78H | Recombinant Human Prolactin | +Inquiry |
| PRL-741P | Recombinant Pig PRL Protein (31-229 aa), His-SUMO-tagged | +Inquiry |
| Prl-1651M | Recombinant Mouse Prl protein, His-tagged | +Inquiry |
| PRL-2590H | Recombinant Human PRL Protein (Leu29-Cys227), His tagged | +Inquiry |
| PRL-4497H | Recombinant Horse PRL protein, hFc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRL-111S | Active Native Sheep Prolactin | +Inquiry |
| PRL-8245H | Native Human Prolactin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *
