Recombinant Human PRL Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PRL-6262H |
Product Overview : | PRL MS Standard C13 and N15-labeled recombinant protein (NP_000939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. |
Molecular Mass : | 25.9 kDa |
AA Sequence : | MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PRL prolactin [ Homo sapiens (human) ] |
Official Symbol | PRL |
Synonyms | PRL; prolactin; GHA1; prolactin; decidual prolactin; growth hormone A1 |
Gene ID | 5617 |
mRNA Refseq | NM_000948 |
Protein Refseq | NP_000939 |
MIM | 176760 |
UniProt ID | P01236 |
◆ Recombinant Proteins | ||
PRL-7015C | Recombinant Chicken PRL | +Inquiry |
PRL-2590H | Recombinant Human PRL Protein (Leu29-Cys227), His tagged | +Inquiry |
PRL-1194C | Recombinant Cattle PRL Protein, His-tagged | +Inquiry |
Prl-1651M | Recombinant Mouse Prl protein, His-tagged | +Inquiry |
PRL-6262H | Recombinant Human PRL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
PRL-8245H | Native Human Prolactin | +Inquiry |
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *