Recombinant Horse SAA1 Protein (1-110 aa), His-tagged

• Cat.No.: SAA1-795H
• Product Overview: Recombinant Horse SAA1 Protein (1-110 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Horse
• Source: E.coli
• Tag: His
• Protein Length: 1-110 aa
• Description: Major acute phase reactant. Apolipoprotein of the HDL complex.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 16.3 kDa
• AA Sequence: LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: SAA1 serum amyloid A1 [ Equus caballus ]
• Official Symbol: SAA1
• Synonyms: SAA1; serum amyloid A1; SAA
• Gene ID: 100034017
• mRNA Refseq: NM_001163892
• Protein Refseq: NP_001157364
• UniProt ID: P19857