"SAA1" Related Products

Expand
Expand
Expand

Recombinant Horse SAA1 Protein (1-110 aa), His-tagged

Cat.No. : SAA1-795H
Product Overview : Recombinant Horse SAA1 Protein (1-110 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
Description : Major acute phase reactant. Apolipoprotein of the HDL complex.
Source : E. coli
Species : Horse
Tag : His
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 16.3 kDa
Protein length : 1-110 aa
AA Sequence : LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : SAA1 serum amyloid A1 [ Equus caballus ]
Official Symbol : SAA1
Synonyms : SAA1; serum amyloid A1; SAA;
Gene ID : 100034017
mRNA Refseq : NM_001163892
Protein Refseq : NP_001157364
UniProt ID : P19857

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.