Recombinant HPV-16 E6 protein, His-tagged
| Cat.No. : | E6-03H |
| Product Overview : | Recombinant HPV-16 E6 protein(P03126)(1-158aa), fused with His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HPV16 |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-158 aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.2 kDa |
| AA Sequence : | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 mg/ml. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
| ◆ Recombinant Proteins | ||
| E6-14H | Recombinant HPV16 E6 Protein, His tagged | +Inquiry |
| E6-5721H | Recombinant Human papillomavirus type 16 E6 protein, His-tagged | +Inquiry |
| E6-3830H | Recombinant HPV-18 E6 Protein (Full length), N-His tagged | +Inquiry |
| E6-02P | Recombinant HPV16 E6 Protein, His-tagged | +Inquiry |
| E6-5678H | Recombinant Human E6 protein, His&His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E6 Products
Required fields are marked with *
My Review for All E6 Products
Required fields are marked with *
