Recombinant HPV-16 E6 protein, His-tagged

Cat.No. : E6-03H
Product Overview : Recombinant HPV-16 E6 protein(P03126)(1-158aa), fused with His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HPV16
Source : E.coli
Tag : His
Protein Length : 1-158aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 23.2 kDa
AA Sequence : MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 mg/ml. Centrifuge the vial at 4℃ before opening to recover the entire contents.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E6 Products

Required fields are marked with *

My Review for All E6 Products

Required fields are marked with *

0
cart-icon
0
compare icon