Recombinant HPV-16 L2 Protein, His-tagged
Cat.No. : | L2-1727H |
Product Overview : | Recombinant HPV-16 L2 protein with a His-tag was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPV16 |
Source : | E.coli |
Tag : | His |
Description : | HPV is a common sexually transmitted infection which usually shows no symptoms and goes away by itself, but can sometimes cause serious illness. |
Molecular Mass : | The protein has a calculated MW of 51 kDa. |
AA Sequence : | MRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGKTIADQILQYGSMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDPAFVTTPTKLITYDNPAYEGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTGIRYSRIGNKQTLRTRSGKSIGAKVHYYYDLSTIDPAEEIELQTITPSTYTTTSHAASPTSINNGLYDIYADDFITDTSTTPVPSVPSTSLSGYIPANTTIPFGGAYNIPLVSGPDIPINITDQAPSLIPIVPGSPQYTIIADAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAAHHHHHH |
Purity : | >95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.32 mg/mL |
Storage Buffer : | PBS pH7.4, 0.5% SKL |
Official Symbol | L2 |
Synonyms | L2 |
◆ Recombinant Proteins | ||
L2-001H | Recombinant HPV 16 L2 Protein, His-tagged | +Inquiry |
L2-1732H | Recombinant HPV-53 L2 Protein | +Inquiry |
L2-4256H | Recombinant Human papillomavirus type 16 L2 protein, His-SUMO-tagged | +Inquiry |
L2-1733H | Recombinant HPV-6 L2 Protein | +Inquiry |
L2-1729H | Recombinant HPV-26 L2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All L2 Products
Required fields are marked with *
My Review for All L2 Products
Required fields are marked with *