Recombinant HPV-16 L2 Protein, His-tagged

Cat.No. : L2-1727H
Product Overview : Recombinant HPV-16 L2 protein with a His-tag was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HPV16
Source : E.coli
Tag : His
Description : HPV is a common sexually transmitted infection which usually shows no symptoms and goes away by itself, but can sometimes cause serious illness.
Molecular Mass : The protein has a calculated MW of 51 kDa.
AA Sequence : MRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGKTIADQILQYGSMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDPAFVTTPTKLITYDNPAYEGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTGIRYSRIGNKQTLRTRSGKSIGAKVHYYYDLSTIDPAEEIELQTITPSTYTTTSHAASPTSINNGLYDIYADDFITDTSTTPVPSVPSTSLSGYIPANTTIPFGGAYNIPLVSGPDIPINITDQAPSLIPIVPGSPQYTIIADAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAAHHHHHH
Purity : >95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.32 mg/mL
Storage Buffer : PBS pH7.4, 0.5% SKL
Official Symbol L2
Synonyms L2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All L2 Products

Required fields are marked with *

My Review for All L2 Products

Required fields are marked with *

0
cart-icon