Recombinant HPV16 E6 Protein, GST tagged

Cat.No. : E6-548H
Product Overview : Recombinant HPV16 E6 Protein with GST tag was expressed in E.coli.
Availability October 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HPV16
Source : E.coli
Tag : GST
Protein Length : 1-158 aa
Description : Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway.
Form : Sterile 50mM Tris, 500mM NaCl, 2mM DTT
Molecular Mass : 46 kDa
AASequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL
Endotoxin : < 0.1 EU/μg by LAL
Purity : >80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.56 mg/mL by Bradford
Gene Name E6 protein E6*;transforming protein E6 [ Human papillomavirus 16 ]
Official Symbol E6
Synonyms E6; protein E6*;transforming protein E6; protein E6*;transforming protein E6; Oncoprotein. It has long been recognized as a potent oncogene and is intimately associated with the events that result in the malignant conversion of virally infected cells.; Spliced. E6*. Function is not known yet.
Gene ID 1489078
Protein Refseq NP_041325
UniProt ID P03126

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E6 Products

Required fields are marked with *

My Review for All E6 Products

Required fields are marked with *

0
cart-icon
0
compare icon