| Species : |
HPV6 |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-150 aa |
| Description : |
Human papillomavirus (HPV) is a common virus that can affect different parts of your body. There are over 100 types of HPV, including strains of HPV that cause warts on your hands, feet, face, etc. About 30 HPV strains can affect your genitals, including your vulva, vagina, cervix, penis and scrotum, as well as your rectum and anus. |
| Molecular Mass : |
The protein has a calculated MW of 18 kDa. |
| AA Sequence : |
MESANASTSATTIDQLCKTFNLSMHTLQINCVFCKNALTTAEIYSYAYKHLKVLFRGGYPYAACACCLEFHGKINQYRHFDYAGYATTVEEETKQDILDVLIRCYLCHKPLCEVEKVKHILTKARFIKLNCTWKGRCLHCWTTCMEDMLPLEHHHHHH |
| Purity : |
> 95% by SDS-PAGE |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
1 mg/mL by BCA |
| Storage Buffer : |
Sterile 100 mM Tris, 400 mM Arginine, pH 8.0 |