Recombinant HPV31 L1 Protein

• Cat.No.: HPV31-L1-05H
• Product Overview: Recombinant HPV31 L1 Protein without tag was expressed in E.coli.

Specification

• Species: HPV31
• Source: E.coli
• Description: HPV (human papillomavirus) is a sexually transmitted virus. It is passed on through genital contact (such as vaginal and anal sex). It is also passed on by skin-to-skin contact. HPV is not a new virus. But many people don't know about it. Most people don't have any signs. HPV may go away on its own-- without causing any health problems.
• Molecular Mass: 57 kDa
• AA Sequence: MSLWRPSEATVYLPPVPVSKVVSTDEYVTRTNIYYHAGSARLLTVGHPYYSIPKSDNPKKIVVPKVSGLQYRVFRVRLPDPNKFGFPDTSFYNPETQRLVWACVGLEVGRGQPLGVGISGHPLLNKFDDTENSNRYAGGPGTDNRECISMDYKQTQLCLLGCKPPIGEHWGKGSPCSNNAITPGDCPPLELKNSVIQDGDMVDTGFGAMDFTALQDTKSNVPLDICNSICKYPDYLKMVAEPYGDTLFFYLRREQMFVRHFFNRSGTVGESVPTDLYIKGSGSTATLANSTYFPTPSGSMVTSDAQIFNKPYWMQRAQGHNNGICWGNQLFVTVVDTTRSTNMSVCAAIANSDTTFKSSNFKEYLRHGEEFDLQFIFQLCKITLSADIMTYIHSMNPAILEDWNFGLTTPPSGSLEDTYRFVTSQAITCQKTAPQKPKEDPFKDYVFWEVNLKEKFSADLDQFPLGRKFLLQAGYRARPKFKAGKRSAPSASTTTPAKRKKTKKHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL method
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.05 mg/mL
• Storage Buffer: PBS, 0.05% SKL, pH 7.4

Gene Information

• Synonyms: L1; HPV31 major capsid protein L1; Human papilloma virus type 31 major capsid protein L1; Human papillomavirus type 31 L1; Human papillomavirus type 31 major capsid protein L1; Major capsid protein L1