Recombinant Human A1CF protein, His-tagged
| Cat.No. : | A1CF-3507H |
| Product Overview : | Recombinant Human A1CF protein(1-122 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-122 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | A1CF APOBEC1 complementation factor [ Homo sapiens ] |
| Official Symbol | A1CF |
| Synonyms | A1CF; APOBEC1 complementation factor; ACF; ACF64; ACF65; APOBEC1CF; ASP; apo-B RNA editing protein; APOBEC-1 stimulating protein; apobec-1 complementation factor (ACF) (ASP); RP11-564C4.2; MGC163391; |
| Gene ID | 29974 |
| mRNA Refseq | NM_001198818 |
| Protein Refseq | NP_001185747 |
| UniProt ID | Q9NQ94 |
| ◆ Recombinant Proteins | ||
| A1CF-31R | Recombinant Rat A1CF Protein, His (Fc)-Avi-tagged | +Inquiry |
| A1CF-0375H | Recombinant Human A1CF Protein (Gly389-Arg587), His-tagged | +Inquiry |
| A1CF-0376H | Recombinant Human A1CF Protein (Gly389-Arg587), N-His-tagged | +Inquiry |
| A1CF-1197H | Recombinant Human A1CF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| A1cf-01M | Recombinant Mouse A1cf Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| A1CF-9165HCL | Recombinant Human A1CF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A1CF Products
Required fields are marked with *
My Review for All A1CF Products
Required fields are marked with *
