Recombinant Human A2M protein(1161-1250 aa), C-His-tagged

• Cat.No.: A2M-2504H
• Product Overview: Recombinant Human A2M protein(P01023)(1161-1250 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1161-1250 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSS

Gene Information

• Gene Name: A2M alpha-2-macroglobulin [ Homo sapiens ]
• Official Symbol: A2M
• Synonyms: A2M; alpha-2-macroglobulin; CPAMD5; FWP007; S863 7; alpha-2-M; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; A2MD; S863-7; DKFZp779B086
• Gene ID: 2
• mRNA Refseq: NM_000014
• Protein Refseq: NP_000005
• MIM: 103950
• UniProt ID: P01023