Recombinant Human A2M protein(1161-1250 aa), C-His-tagged
Cat.No. : | A2M-2504H |
Product Overview : | Recombinant Human A2M protein(P01023)(1161-1250 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1161-1250 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSS |
Gene Name | A2M alpha-2-macroglobulin [ Homo sapiens ] |
Official Symbol | A2M |
Synonyms | A2M; alpha-2-macroglobulin; CPAMD5; FWP007; S863 7; alpha-2-M; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; A2MD; S863-7; DKFZp779B086; |
Gene ID | 2 |
mRNA Refseq | NM_000014 |
Protein Refseq | NP_000005 |
MIM | 103950 |
UniProt ID | P01023 |
◆ Recombinant Proteins | ||
A2M-6857H | Active Recombinant Human A2M protein, His-tagged | +Inquiry |
A2M-13H | Recombinant Human A2M Protein, N-His-tagged | +Inquiry |
A2M-377R | Recombinant Rat A2M Protein | +Inquiry |
A2M-32R | Recombinant Rat A2M Protein, His (Fc)-Avi-tagged | +Inquiry |
A2M-239H | Recombinant Human A2M Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
A2m-8030M | Native Mouse A2m | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPBT-27113MM | Mouse Anti-Mouse A2M Polyclonal Antibody | +Inquiry |
A2M-593HCL | Recombinant Human A2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A2M Products
Required fields are marked with *
My Review for All A2M Products
Required fields are marked with *