Recombinant Human A2M protein(1161-1250 aa), C-His-tagged

Cat.No. : A2M-2504H
Product Overview : Recombinant Human A2M protein(P01023)(1161-1250 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1161-1250 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 11.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DKRKEVLKSLNEEAVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSS
Gene Name A2M alpha-2-macroglobulin [ Homo sapiens ]
Official Symbol A2M
Synonyms A2M; alpha-2-macroglobulin; CPAMD5; FWP007; S863 7; alpha-2-M; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; A2MD; S863-7; DKFZp779B086;
Gene ID 2
mRNA Refseq NM_000014
Protein Refseq NP_000005
MIM 103950
UniProt ID P01023

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All A2M Products

Required fields are marked with *

My Review for All A2M Products

Required fields are marked with *

0

Inquiry Basket

cartIcon