Recombinant Human A2M Protein, GST-tagged
| Cat.No. : | A2M-003H |
| Product Overview : | Human A2M partial ORF ( NP_000005.2, 641 a.a. - 730 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimer's disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified. [provided by RefSeq, Nov 2016] |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | A2M alpha-2-macroglobulin [ Homo sapiens ] |
| Official Symbol | A2M |
| Synonyms | A2M; alpha-2-macroglobulin; CPAMD5; FWP007; S863 7; alpha-2-M; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; A2MD; S863-7; DKFZp779B086; |
| Gene ID | 2 |
| mRNA Refseq | NM_000014 |
| Protein Refseq | NP_000005 |
| MIM | 103950 |
| UniProt ID | P01023 |
| ◆ Recombinant Proteins | ||
| A2m-5732M | Recombinant Mouse A2m protein, His-tagged | +Inquiry |
| A2M-499H | Recombinant Human A2M Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| A2m-02M | Recombinant Mouse A2m Protein, His-tagged | +Inquiry |
| A2M-239H | Recombinant Human A2M Protein, His (Fc)-Avi-tagged | +Inquiry |
| A2M-4176H | Human Alpha-2-Macroglobulin | +Inquiry |
| ◆ Native Proteins | ||
| A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
| A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
| A2M-01H | Native Human A2M Protein | +Inquiry |
| A2m-8030M | Native Mouse A2m | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| A2M-593HCL | Recombinant Human A2M cell lysate | +Inquiry |
| CPBT-27113MM | Mouse Anti-Mouse A2M Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A2M Products
Required fields are marked with *
My Review for All A2M Products
Required fields are marked with *
