Recombinant Human A2M Protein, GST-tagged

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimer's disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified. [provided by RefSeq, Nov 2016]
Molecular Mass :	35.64 kDa
AA Sequence :	DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	A2M alpha-2-macroglobulin [ Homo sapiens ]
Official Symbol	A2M
Synonyms	A2M; alpha-2-macroglobulin; CPAMD5; FWP007; S863 7; alpha-2-M; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5; A2MD; S863-7; DKFZp779B086;
Gene ID	2
mRNA Refseq	NM_000014
Protein Refseq	NP_000005
MIM	103950
UniProt ID	P01023