Recombinant Human A4GNT protein, His-tagged
| Cat.No. : | A4GNT-2462H |
| Product Overview : | Recombinant Human A4GNT protein(76-340 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 31, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 76-340 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | KIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSDIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | A4GNT alpha-1,4-N-acetylglucosaminyltransferase [ Homo sapiens ] |
| Official Symbol | A4GNT |
| Synonyms | A4GNT; alpha-1,4-N-acetylglucosaminyltransferase; alpha4GnT; MGC149493; |
| Gene ID | 51146 |
| mRNA Refseq | NM_016161 |
| Protein Refseq | NP_057245 |
| UniProt ID | Q9UNA3 |
| ◆ Recombinant Proteins | ||
| A4GNT-17H | Recombinant Human A4GNT, His-DHFR-tagged | +Inquiry |
| A4GNT-16H | Recombinant Human A4GNT, His-tagged | +Inquiry |
| A4GNT-2462H | Recombinant Human A4GNT protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| A4GNT-9162HCL | Recombinant Human A4GNT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A4GNT Products
Required fields are marked with *
My Review for All A4GNT Products
Required fields are marked with *
