Recombinant Human A4GNT, His-tagged
Cat.No. : | A4GNT-16H |
Product Overview : | Recombinant Human α-1,4-N-Acetylglucosaminyltransferase/A4GNT is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys26-Lys340) of Human A4GNT fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 26-340 a.a. |
AA Sequence : | AKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERMEPPHLVSCSVESAAKIYPEWPVVFFMKG LTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINASAERNWLHISSDASR LAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSDI WGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVS YALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNKVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg) |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | A4GNT alpha-1,4-N-acetylglucosaminyltransferase [ Homo sapiens ] |
Official Symbol | A4GNT |
Synonyms | A4GNT; alpha-1,4-N-acetylglucosaminyltransferase; alpha4GnT; MGC149493; |
Gene ID | 51146 |
mRNA Refseq | NM_016161 |
Protein Refseq | NP_057245 |
UniProt ID | Q9UNA3 |
Chromosome Location | 3p14.3 |
Function | acetylglucosaminyltransferase activity; galactosyltransferase activity; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
A4GNT-17H | Recombinant Human A4GNT, His-DHFR-tagged | +Inquiry |
A4GNT-16H | Recombinant Human A4GNT, His-tagged | +Inquiry |
A4GNT-2462H | Recombinant Human A4GNT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
A4GNT-9162HCL | Recombinant Human A4GNT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A4GNT Products
Required fields are marked with *
My Review for All A4GNT Products
Required fields are marked with *