Recombinant Human A4GNT, His-tagged
| Cat.No. : | A4GNT-16H | 
| Product Overview : | Recombinant Human α-1,4-N-Acetylglucosaminyltransferase/A4GNT is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys26-Lys340) of Human A4GNT fused with a polyhistidine tag at the C-terminus. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | His | 
| Protein Length : | 26-340 a.a. | 
| AA Sequence : | AKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERMEPPHLVSCSVESAAKIYPEWPVVFFMKG LTDSTPMPSNSTYPAFSFLSAIDNVFLFPLDMKRLLEDTPLFSWYNQINASAERNWLHISSDASR LAIIWKYGGIYMDTDVISIRPIPEENFLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSDI WGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVS YALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNKVDHHHHHH | 
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg) | 
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
| Gene Name | A4GNT alpha-1,4-N-acetylglucosaminyltransferase [ Homo sapiens ] | 
| Official Symbol | A4GNT | 
| Synonyms | A4GNT; alpha-1,4-N-acetylglucosaminyltransferase; alpha4GnT; MGC149493; | 
| Gene ID | 51146 | 
| mRNA Refseq | NM_016161 | 
| Protein Refseq | NP_057245 | 
| UniProt ID | Q9UNA3 | 
| Chromosome Location | 3p14.3 | 
| Function | acetylglucosaminyltransferase activity; galactosyltransferase activity; transferase activity, transferring glycosyl groups; | 
| ◆ Recombinant Proteins | ||
| A4GNT-16H | Recombinant Human A4GNT, His-tagged | +Inquiry | 
| A4GNT-17H | Recombinant Human A4GNT, His-DHFR-tagged | +Inquiry | 
| A4GNT-2462H | Recombinant Human A4GNT protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| A4GNT-9162HCL | Recombinant Human A4GNT 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All A4GNT Products
Required fields are marked with *
My Review for All A4GNT Products
Required fields are marked with *
  
        
    
      
            