Recombinant Human AAAS Protein, GST-tagged
Cat.No. : | AAAS-007H |
Product Overview : | Human AAAS partial ORF ( NP_056480, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the WD-repeat family of regulatory proteins and may be involved in normal development of the peripheral and central nervous system. The encoded protein is part of the nuclear pore complex and is anchored there by NDC1. Defects in this gene are a cause of achalasia-addisonianism-alacrima syndrome (AAAS), also called triple-A syndrome or Allgrove syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKRCINIWRDVGLFGVLNEIANSE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AAAS achalasia, adrenocortical insufficiency, alacrimia [ Homo sapiens ] |
Official Symbol | AAAS |
Synonyms | AAAS; achalasia, adrenocortical insufficiency, alacrimia; achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple A); aladin; Allgrove; triple A; Allgrove, triple-A; AAA; AAASb; GL003; ALADIN; ADRACALA; ADRACALIN; DKFZp586G1624; |
Gene ID | 8086 |
mRNA Refseq | NM_001173466 |
Protein Refseq | NP_001166937 |
MIM | 605378 |
UniProt ID | Q9NRG9 |
◆ Recombinant Proteins | ||
AAAS-007H | Recombinant Human AAAS Protein, GST-tagged | +Inquiry |
AAAS-006H | Recombinant Human AAAS Protein, GST-tagged | +Inquiry |
Aaas-3246M | Recombinant Mouse Aaas, His-tagged | +Inquiry |
AAAS-1054M | Recombinant Mouse AAAS Protein | +Inquiry |
AAAS-12428Z | Recombinant Zebrafish AAAS | +Inquiry |
◆ Cell & Tissue Lysates | ||
AAAS-9161HCL | Recombinant Human AAAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAAS Products
Required fields are marked with *
My Review for All AAAS Products
Required fields are marked with *