Recombinant Human AAAS Protein, GST-tagged

Cat.No. : AAAS-007H
Product Overview : Human AAAS partial ORF ( NP_056480, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the WD-repeat family of regulatory proteins and may be involved in normal development of the peripheral and central nervous system. The encoded protein is part of the nuclear pore complex and is anchored there by NDC1. Defects in this gene are a cause of achalasia-addisonianism-alacrima syndrome (AAAS), also called triple-A syndrome or Allgrove syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
Molecular Mass : 36.74 kDa
AA Sequence : MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKRCINIWRDVGLFGVLNEIANSE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AAAS achalasia, adrenocortical insufficiency, alacrimia [ Homo sapiens ]
Official Symbol AAAS
Synonyms AAAS; achalasia, adrenocortical insufficiency, alacrimia; achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple A); aladin; Allgrove; triple A; Allgrove, triple-A; AAA; AAASb; GL003; ALADIN; ADRACALA; ADRACALIN; DKFZp586G1624;
Gene ID 8086
mRNA Refseq NM_001173466
Protein Refseq NP_001166937
MIM 605378
UniProt ID Q9NRG9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AAAS Products

Required fields are marked with *

My Review for All AAAS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon