Recombinant Human AADAC Protein (24-399 aa), His-SUMO-Myc-tagged
Cat.No. : | AADAC-2183H |
Product Overview : | Recombinant Human AADAC Protein (24-399 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 24-399 aa |
Description : | Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 63.1 kDa |
AA Sequence : | PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | AADAC arylacetamide deacetylase (esterase) [ Homo sapiens ] |
Official Symbol | AADAC |
Synonyms | AADAC; arylacetamide deacetylase (esterase); arylacetamide deacetylase; CES5A1; DAC; |
Gene ID | 13 |
mRNA Refseq | NM_001086 |
Protein Refseq | NP_001077 |
MIM | 600338 |
UniProt ID | P22760 |
◆ Recombinant Proteins | ||
AADAC-3650H | Recombinant Human AADAC, His-tagged | +Inquiry |
AADAC-2183H | Recombinant Human AADAC Protein (24-399 aa), His-SUMO-Myc-tagged | +Inquiry |
AADAC-36R | Recombinant Rat AADAC Protein, His (Fc)-Avi-tagged | +Inquiry |
AADAC-3902H | Recombinant Human AADAC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Aadac-1449M | Recombinant Mouse Aadac Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AADAC-9160HCL | Recombinant Human AADAC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AADAC Products
Required fields are marked with *
My Review for All AADAC Products
Required fields are marked with *
0
Inquiry Basket