Recombinant Human AADAC Protein, GST-tagged
| Cat.No. : | AADAC-011H |
| Product Overview : | Human AADAC partial ORF ( NP_001077, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AADAC arylacetamide deacetylase (esterase) [ Homo sapiens ] |
| Official Symbol | AADAC |
| Synonyms | AADAC; arylacetamide deacetylase (esterase); arylacetamide deacetylase; CES5A1; DAC; |
| Gene ID | 13 |
| mRNA Refseq | NM_001086 |
| Protein Refseq | NP_001077 |
| MIM | 600338 |
| UniProt ID | P22760 |
| ◆ Recombinant Proteins | ||
| AADAC-745HF | Recombinant Full Length Human AADAC Protein, GST-tagged | +Inquiry |
| AADAC-9288HFL | Recombinant Full Length Human AADAC protein, Flag-tagged | +Inquiry |
| AADAC-381R | Recombinant Rat AADAC Protein | +Inquiry |
| AADAC-011H | Recombinant Human AADAC Protein, GST-tagged | +Inquiry |
| Aadac-1449M | Recombinant Mouse Aadac Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AADAC-9160HCL | Recombinant Human AADAC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AADAC Products
Required fields are marked with *
My Review for All AADAC Products
Required fields are marked with *
