Recombinant Human AADAC Protein, GST-tagged

Cat.No. : AADAC-011H
Product Overview : Human AADAC partial ORF ( NP_001077, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AADAC arylacetamide deacetylase (esterase) [ Homo sapiens ]
Official Symbol AADAC
Synonyms AADAC; arylacetamide deacetylase (esterase); arylacetamide deacetylase; CES5A1; DAC;
Gene ID 13
mRNA Refseq NM_001086
Protein Refseq NP_001077
MIM 600338
UniProt ID P22760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AADAC Products

Required fields are marked with *

My Review for All AADAC Products

Required fields are marked with *

0
cart-icon
0
compare icon