Recombinant Human AADAC protein, His-tagged
Cat.No. : | AADAC-2193H |
Product Overview : | Recombinant Human AADAC protein(P22760)(24-399aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 24-399aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.6 kDa |
AA Sequence : | PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AADAC arylacetamide deacetylase (esterase) [ Homo sapiens ] |
Official Symbol | AADAC |
Synonyms | AADAC; arylacetamide deacetylase (esterase); arylacetamide deacetylase; CES5A1; DAC; |
Gene ID | 13 |
mRNA Refseq | NM_001086 |
Protein Refseq | NP_001077 |
MIM | 600338 |
UniProt ID | P22760 |
◆ Recombinant Proteins | ||
AADAC-36R | Recombinant Rat AADAC Protein, His (Fc)-Avi-tagged | +Inquiry |
AADAC-170M | Recombinant Mouse AADAC Protein, His (Fc)-Avi-tagged | +Inquiry |
AADAC-2474H | Recombinant Human AADAC protein, His-tagged | +Inquiry |
AADAC-2183H | Recombinant Human AADAC Protein (24-399 aa), His-SUMO-Myc-tagged | +Inquiry |
AADAC-3902H | Recombinant Human AADAC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AADAC-9160HCL | Recombinant Human AADAC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AADAC Products
Required fields are marked with *
My Review for All AADAC Products
Required fields are marked with *
0
Inquiry Basket