Recombinant Human AADACL2 protein, His-tagged
| Cat.No. : | AADACL2-4533H |
| Product Overview : | Recombinant Human AADACL2 protein(1-74 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-74 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEEFISMIFRLDYTQPLSDEYITVTDTTFVDIPVRLYLP |
| Gene Name | AADACL2 arylacetamide deacetylase-like 2 [ Homo sapiens ] |
| Official Symbol | AADACL2 |
| Synonyms | AADACL2; arylacetamide deacetylase-like 2; MGC72001; |
| Gene ID | 344752 |
| mRNA Refseq | NM_207365 |
| Protein Refseq | NP_997248 |
| UniProt ID | Q6P093 |
| ◆ Recombinant Proteins | ||
| AADACL2-1456H | Recombinant Human AADACL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AADACL2-747HF | Recombinant Full Length Human AADACL2 Protein, GST-tagged | +Inquiry |
| AADACL2-4533H | Recombinant Human AADACL2 protein, His-tagged | +Inquiry |
| AADACL2-013H | Recombinant Human AADACL2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AADACL2-9159HCL | Recombinant Human AADACL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AADACL2 Products
Required fields are marked with *
My Review for All AADACL2 Products
Required fields are marked with *
