Recombinant Human AADAT protein, GST-tagged
| Cat.No. : | AADAT-301515H |
| Product Overview : | Recombinant Human AADAT (81-429 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ser81-Leu429 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | SAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | AADAT aminoadipate aminotransferase [ Homo sapiens ] |
| Official Symbol | AADAT |
| Synonyms | AADAT; aminoadipate aminotransferase; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; KAT2; KATII; kynurenine aminotransferase II; L kynurenine/alpha aminoadipate aminotransferase; KAT/AadAT; 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; alpha-aminoadipate aminotransferase; kynurenine--oxoglutarate transaminase II; kynurenine--oxoglutarate aminotransferase II; |
| Gene ID | 51166 |
| mRNA Refseq | NM_016228 |
| Protein Refseq | NP_057312 |
| MIM | 611754 |
| UniProt ID | Q8N5Z0 |
| ◆ Recombinant Proteins | ||
| AADAT-301515H | Recombinant Human AADAT protein, GST-tagged | +Inquiry |
| AADAT-4693H | Recombinant Human AADAT protein, His-SUMO-tagged | +Inquiry |
| AADAT-015H | Recombinant Human AADAT Protein, GST-tagged | +Inquiry |
| AADAT-2116H | Recombinant Human AADAT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AADAT-382R | Recombinant Rat AADAT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AADAT-9158HCL | Recombinant Human AADAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AADAT Products
Required fields are marked with *
My Review for All AADAT Products
Required fields are marked with *
