Recombinant Human AADAT protein, GST-tagged

Cat.No. : AADAT-301515H
Product Overview : Recombinant Human AADAT (81-429 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ser81-Leu429
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : SAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name AADAT aminoadipate aminotransferase [ Homo sapiens ]
Official Symbol AADAT
Synonyms AADAT; aminoadipate aminotransferase; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; KAT2; KATII; kynurenine aminotransferase II; L kynurenine/alpha aminoadipate aminotransferase; KAT/AadAT; 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; alpha-aminoadipate aminotransferase; kynurenine--oxoglutarate transaminase II; kynurenine--oxoglutarate aminotransferase II;
Gene ID 51166
mRNA Refseq NM_016228
Protein Refseq NP_057312
MIM 611754
UniProt ID Q8N5Z0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AADAT Products

Required fields are marked with *

My Review for All AADAT Products

Required fields are marked with *

0
cart-icon
0
compare icon