Recombinant Human AADC Protein, His-tagged
| Cat.No. : | AADC-01H |
| Product Overview : | Recombinant Human AADC Protein with His tag was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The encoded protein catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD). AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. |
| Molecular Mass : | 48.64 kDa |
| AA Sequence : | MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKHHHHHHHH |
| Purity : | > 85% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.5 mg/mL |
| Storage Buffer : | PBS, pH 7.4 |
| Gene Name | DDC dopa decarboxylase [ Homo sapiens (human) ] |
| Official Symbol | DDC |
| Synonyms | DDC; dopa decarboxylase; AADC; aromatic-L-amino-acid decarboxylase; dopa decarboxylase (aromatic L-amino acid decarboxylase); EC 4.1.1.28 |
| Gene ID | 1644 |
| mRNA Refseq | NM_000790 |
| Protein Refseq | NP_000781 |
| MIM | 107930 |
| ◆ Recombinant Proteins | ||
| AADC-01H | Recombinant Human AADC Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AADC Products
Required fields are marked with *
My Review for All AADC Products
Required fields are marked with *
