Recombinant Human AAMDC Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AAMDC-1283H |
Product Overview : | C11orf67 MS Standard C13 and N15-labeled recombinant protein (NP_078960) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May play a role in preadipocyte differentiation and adipogenesis. |
Molecular Mass : | 13.3 kDa |
AA Sequence : | MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AAMDC adipogenesis associated Mth938 domain containing [ Homo sapiens (human) ] |
Official Symbol | AAMDC |
Synonyms | AAMDC; adipogenesis associated Mth938 domain containing; CK067; PTD015; C11orf67; mth938 domain-containing protein; UPF0366 protein C11orf67; adipogenesis associated Mth938 domain-containing protein |
Gene ID | 28971 |
mRNA Refseq | NM_024684 |
Protein Refseq | NP_078960 |
UniProt ID | Q9H7C9 |
◆ Recombinant Proteins | ||
AAMDC-243H | Recombinant Human AAMDC Protein, MYC/DDK-tagged | +Inquiry |
AAMDC-1317H | Recombinant Human AAMDC | +Inquiry |
AAMDC-333H | Recombinant Human AAMDC Protein, His-tagged | +Inquiry |
Aamdc-1451M | Recombinant Mouse Aamdc Protein, Myc/DDK-tagged | +Inquiry |
AAMDC-2394H | Recombinant Human AAMDC Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAMDC Products
Required fields are marked with *
My Review for All AAMDC Products
Required fields are marked with *