Recombinant Human AAMP Protein, GST-tagged

Cat.No. : AAMP-020H
Product Overview : Human AAMP partial ORF ( NP_001078.2, 111 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion. [provided by RefSeq, Oct 2014]
Molecular Mass : 36.74 kDa
AA Sequence : GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AAMP angio-associated, migratory cell protein [ Homo sapiens ]
Official Symbol AAMP
Synonyms AAMP; angio-associated, migratory cell protein; angio-associated migratory cell protein;
Gene ID 14
mRNA Refseq NM_001087
Protein Refseq NP_001078
MIM 603488
UniProt ID Q13685

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AAMP Products

Required fields are marked with *

My Review for All AAMP Products

Required fields are marked with *

0
cart-icon
0
compare icon