Recombinant Human ALDH3B2 protein, His-tagged
| Cat.No. : | ALDH3B2-498H |
| Product Overview : | Recombinant Human ALDH3B2 protein(92-385 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 92-385 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | TGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
| Gene Name | ALDH3B2 aldehyde dehydrogenase 3 family, member B2 [ Homo sapiens ] |
| Official Symbol | ALDH3B2 |
| Synonyms | ALDH3B2; aldehyde dehydrogenase 3 family, member B2; ALDH8; aldehyde dehydrogenase family 3 member B2; acetaldehyde dehydrogenase 8; aldehyde dehydrogenase 8; |
| Gene ID | 222 |
| mRNA Refseq | NM_000695 |
| Protein Refseq | NP_000686 |
| MIM | 601917 |
| UniProt ID | P48448 |
| ◆ Recombinant Proteins | ||
| ALDH3B2-498H | Recombinant Human ALDH3B2 protein, His-tagged | +Inquiry |
| AAMP-019H | Recombinant Human AAMP Protein, GST-tagged | +Inquiry |
| AAMP-474H | Recombinant Human AAMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AAMP-12190Z | Recombinant Zebrafish AAMP | +Inquiry |
| Aamp-1452M | Recombinant Mouse Aamp Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AAMP-9157HCL | Recombinant Human AAMP 293 Cell Lysate | +Inquiry |
| AAMP-013HKCL | Human AAMP Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAMP Products
Required fields are marked with *
My Review for All AAMP Products
Required fields are marked with *



