Recombinant Human AAMP protein, His-tagged
Cat.No. : | AAMP-3548H |
Product Overview : | Recombinant Human AAMP protein(85-434 aa), fused to His tag, was expressed in E. coli. |
Availability | September 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 85-434 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSGDHKAKVFCVQRPDR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AAMP angio-associated, migratory cell protein [ Homo sapiens ] |
Official Symbol | AAMP |
Synonyms | AAMP; angio-associated, migratory cell protein; angio-associated migratory cell protein; |
Gene ID | 14 |
mRNA Refseq | NM_001087 |
Protein Refseq | NP_001078 |
MIM | 603488 |
UniProt ID | Q13685 |
◆ Recombinant Proteins | ||
AAMP-3548H | Recombinant Human AAMP protein, His-tagged | +Inquiry |
Aamp-1452M | Recombinant Mouse Aamp Protein, Myc/DDK-tagged | +Inquiry |
ALDH3B2-498H | Recombinant Human ALDH3B2 protein, His-tagged | +Inquiry |
AAMP-2R | Recombinant Rhesus Macaque AAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
AAMP-474H | Recombinant Human AAMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AAMP-9157HCL | Recombinant Human AAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAMP Products
Required fields are marked with *
My Review for All AAMP Products
Required fields are marked with *