Recombinant Human AAMP protein, His-tagged
| Cat.No. : | AAMP-3548H |
| Product Overview : | Recombinant Human AAMP protein(85-434 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 85-434 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSGIVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSGDHKAKVFCVQRPDR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AAMP angio-associated, migratory cell protein [ Homo sapiens ] |
| Official Symbol | AAMP |
| Synonyms | AAMP; angio-associated, migratory cell protein; angio-associated migratory cell protein; |
| Gene ID | 14 |
| mRNA Refseq | NM_001087 |
| Protein Refseq | NP_001078 |
| MIM | 603488 |
| UniProt ID | Q13685 |
| ◆ Recombinant Proteins | ||
| AAMP-242H | Recombinant Human AAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
| AAMP-2R | Recombinant Rhesus Macaque AAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
| AAMP-12190Z | Recombinant Zebrafish AAMP | +Inquiry |
| ALDH3B2-498H | Recombinant Human ALDH3B2 protein, His-tagged | +Inquiry |
| Aamp-1452M | Recombinant Mouse Aamp Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AAMP-9157HCL | Recombinant Human AAMP 293 Cell Lysate | +Inquiry |
| AAMP-013HKCL | Human AAMP Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAMP Products
Required fields are marked with *
My Review for All AAMP Products
Required fields are marked with *
