Recombinant Human AASDH Protein, GST-tagged
| Cat.No. : | AASDH-024H |
| Product Overview : | Human AASDH full-length ORF ( AAH15096.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the non-ribosome peptide syntesase (NRPS) enzyme family. The encoded protein contains an AMP-binding domain, PP-binding (phosphopantetheine, or pantetheine 4'phosphate-binding) domain and the Pyrrolo-quinoline quinon (PQQ) binding domain. The protein is expressed in several adult tissues. [provided by RefSeq, Apr 2016] |
| Molecular Mass : | 41.7 kDa |
| AA Sequence : | MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINVSLDVSIVFCLYYIYFN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AASDH aminoadipate-semialdehyde dehydrogenase [ Homo sapiens ] |
| Official Symbol | AASDH |
| Synonyms | AASDH; aminoadipate-semialdehyde dehydrogenase; acyl-CoA synthetase family member 4; ACSF4; acyl CoA synthetase family member 4; LYS2; NRPS998; non-ribosomal peptide synthetase 998; non-ribosomal peptide synthetase 1098; 2-aminoadipic 6-semialdehyde dehydrogenase; NRPS1098; |
| Gene ID | 132949 |
| mRNA Refseq | NM_181806 |
| Protein Refseq | NP_861522 |
| MIM | 614365 |
| UniProt ID | Q4L235 |
| ◆ Recombinant Proteins | ||
| AASDH-655H | Recombinant Human AASDH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AASDH-759HF | Recombinant Full Length Human AASDH Protein, GST-tagged | +Inquiry |
| AASDH-6744H | Recombinant Human AASDH protein, His-tagged | +Inquiry |
| AASDH-024H | Recombinant Human AASDH Protein, GST-tagged | +Inquiry |
| Aasdh-1457M | Recombinant Mouse Aasdh Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AASDH-1HCL | Recombinant Human AASDH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AASDH Products
Required fields are marked with *
My Review for All AASDH Products
Required fields are marked with *
