Recombinant Human AASDH Protein, GST-tagged

Cat.No. : AASDH-024H
Product Overview : Human AASDH full-length ORF ( AAH15096.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the non-ribosome peptide syntesase (NRPS) enzyme family. The encoded protein contains an AMP-binding domain, PP-binding (phosphopantetheine, or pantetheine 4'phosphate-binding) domain and the Pyrrolo-quinoline quinon (PQQ) binding domain. The protein is expressed in several adult tissues. [provided by RefSeq, Apr 2016]
Molecular Mass : 41.7 kDa
AA Sequence : MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINVSLDVSIVFCLYYIYFN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AASDH aminoadipate-semialdehyde dehydrogenase [ Homo sapiens ]
Official Symbol AASDH
Synonyms AASDH; aminoadipate-semialdehyde dehydrogenase; acyl-CoA synthetase family member 4; ACSF4; acyl CoA synthetase family member 4; LYS2; NRPS998; non-ribosomal peptide synthetase 998; non-ribosomal peptide synthetase 1098; 2-aminoadipic 6-semialdehyde dehydrogenase; NRPS1098;
Gene ID 132949
mRNA Refseq NM_181806
Protein Refseq NP_861522
MIM 614365
UniProt ID Q4L235

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AASDH Products

Required fields are marked with *

My Review for All AASDH Products

Required fields are marked with *

0
cart-icon
0
compare icon