Recombinant Human AASDHPPT Protein, GST-tagged
| Cat.No. : | AASDHPPT-025H |
| Product Overview : | Human AASDHPPT full-length ORF ( AAH15470, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 59.73 kDa |
| AA Sequence : | MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTARGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGAGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AASDHPPT aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [ Homo sapiens ] |
| Official Symbol | AASDHPPT |
| Synonyms | AASDHPPT; aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; AASD PPT; CGI 80; LYS5; LYS5 ortholog; 4-phosphopantetheinyl transferase; alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase; LYS2; CGI-80; AASD-PPT; |
| Gene ID | 60496 |
| mRNA Refseq | NM_015423 |
| Protein Refseq | NP_056238 |
| MIM | 607756 |
| UniProt ID | Q9NRN7 |
| ◆ Recombinant Proteins | ||
| AASDHPPT-3410Z | Recombinant Zebrafish AASDHPPT | +Inquiry |
| AASDHPPT-797H | Recombinant Human AASDHPPT, His-tagged | +Inquiry |
| AASDHPPT-389R | Recombinant Rat AASDHPPT Protein | +Inquiry |
| AASDHPPT-1479H | Recombinant Human AASDHPPT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AASDHPPT-175R | Recombinant Rhesus monkey AASDHPPT Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AASDHPPT-2HCL | Recombinant Human AASDHPPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AASDHPPT Products
Required fields are marked with *
My Review for All AASDHPPT Products
Required fields are marked with *
