Recombinant Human AATK Protein, GST-tagged

• Cat.No.: AATK-029H
• Product Overview: Human AATK partial ORF ( AAH47378, 161 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
• Molecular Mass: 36.63 kDa
• AA Sequence: SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AATK apoptosis-associated tyrosine kinase [ Homo sapiens ]
• Official Symbol: AATK
• Synonyms: AATK; apoptosis-associated tyrosine kinase; serine/threonine-protein kinase LMTK1; AATYK; AATYK1; KIAA0641; lemur tyrosine kinase 1; LMR1; LMTK1; p35-binding protein; CDK5-binding protein; brain apoptosis-associated tyrosine kinase; p35BP
• Gene ID: 9625
• mRNA Refseq: NM_001080395
• Protein Refseq: NP_001073864
• MIM: 605276
• UniProt ID: Q6ZMQ8