Recombinant Human AATK Protein, GST-tagged

Cat.No. : AATK-029H
Product Overview : Human AATK partial ORF ( AAH47378, 161 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
Molecular Mass : 36.63 kDa
AA Sequence : SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AATK apoptosis-associated tyrosine kinase [ Homo sapiens ]
Official Symbol AATK
Synonyms AATK; apoptosis-associated tyrosine kinase; serine/threonine-protein kinase LMTK1; AATYK; AATYK1; KIAA0641; lemur tyrosine kinase 1; LMR1; LMTK1; p35-binding protein; CDK5-binding protein; brain apoptosis-associated tyrosine kinase; p35BP;
Gene ID 9625
mRNA Refseq NM_001080395
Protein Refseq NP_001073864
MIM 605276
UniProt ID Q6ZMQ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AATK Products

Required fields are marked with *

My Review for All AATK Products

Required fields are marked with *

0
cart-icon