Recombinant Human AATK Protein, GST-tagged
Cat.No. : | AATK-029H |
Product Overview : | Human AATK partial ORF ( AAH47378, 161 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AATK apoptosis-associated tyrosine kinase [ Homo sapiens ] |
Official Symbol | AATK |
Synonyms | AATK; apoptosis-associated tyrosine kinase; serine/threonine-protein kinase LMTK1; AATYK; AATYK1; KIAA0641; lemur tyrosine kinase 1; LMR1; LMTK1; p35-binding protein; CDK5-binding protein; brain apoptosis-associated tyrosine kinase; p35BP; |
Gene ID | 9625 |
mRNA Refseq | NM_001080395 |
Protein Refseq | NP_001073864 |
MIM | 605276 |
UniProt ID | Q6ZMQ8 |
◆ Recombinant Proteins | ||
Aatk-646M | Recombinant Mouse Aatk Protein, His-tagged | +Inquiry |
AATK-6993M | Recombinant Mouse AATK, GST-tagged | +Inquiry |
AATK-3037H | Recombinant house mouse AATK, GST-tagged | +Inquiry |
AATK-645H | Recombinant Human AATK Protein, His-tagged | +Inquiry |
AATK-029H | Recombinant Human AATK Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AATK Products
Required fields are marked with *
My Review for All AATK Products
Required fields are marked with *
0
Inquiry Basket