Recombinant Human ABCA1 protein, GST-tagged
Cat.No. : | ABCA1-178H |
Product Overview : | Recombinant Human ABCA1(86 a.a. - 185 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 86-185 a.a. |
Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesteral efflux pump in the cellular lipid removal pathway. Mutations in this gene have been associated with Tangier's disease and familial high-density lipoprotein deficiency. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYH NLSLPKSTVDKMLRADVILHKVFLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1 [ Homo sapiens ] |
Official Symbol | ABCA1 |
Synonyms | ABCA1; ATP-binding cassette, sub-family A (ABC1), member 1; ABC1, HDLDT1; ATP-binding cassette sub-family A member 1; Tangier disease; TGD; membrane-bound; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein; ABC1; CERP; ABC-1; HDLDT1; |
Gene ID | 19 |
mRNA Refseq | NM_005502 |
Protein Refseq | NP_005493 |
MIM | |
UniProt ID | O95477 |
Chromosome Location | 9q31 |
Pathway | ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; |
Function | ATP binding; ATPase activity; anion transmembrane transporter activity; apolipoprotein A-I binding; apolipoprotein A-I receptor activity; apolipoprotein binding; cholesterol binding; cholesterol transporter activity; nucleotide binding; phospholipid binding; phospholipid transporter activity; protein binding; small GTPase binding; syntaxin binding; |
◆ Recombinant Proteins | ||
ABCA1-10H | Recombinant Human ABCA1 Protein, His-tagged | +Inquiry |
ABCA1-459H | Recombinant Human ABCA1 | +Inquiry |
ABCA1-5857H | Recombinant Human ABCA1 protein, His-tagged | +Inquiry |
ABCA1-0185H | Recombinant Human ABCA1 Protein (Ser45-Glu271), N-His-tagged | +Inquiry |
ABCA1-2398H | Recombinant Human ABCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCA1 Products
Required fields are marked with *
My Review for All ABCA1 Products
Required fields are marked with *