Recombinant Human ABCA1 protein, GST-tagged

Cat.No. : ABCA1-178H
Product Overview : Recombinant Human ABCA1(86 a.a. - 185 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 86-185 a.a.
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesteral efflux pump in the cellular lipid removal pathway. Mutations in this gene have been associated with Tangier's disease and familial high-density lipoprotein deficiency.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYH NLSLPKSTVDKMLRADVILHKVFLQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1 [ Homo sapiens ]
Official Symbol ABCA1
Synonyms ABCA1; ATP-binding cassette, sub-family A (ABC1), member 1; ABC1, HDLDT1; ATP-binding cassette sub-family A member 1; Tangier disease; TGD; membrane-bound; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein; ABC1; CERP; ABC-1; HDLDT1;
Gene ID 19
mRNA Refseq NM_005502
Protein Refseq NP_005493
MIM
UniProt ID O95477
Chromosome Location 9q31
Pathway ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem;
Function ATP binding; ATPase activity; anion transmembrane transporter activity; apolipoprotein A-I binding; apolipoprotein A-I receptor activity; apolipoprotein binding; cholesterol binding; cholesterol transporter activity; nucleotide binding; phospholipid binding; phospholipid transporter activity; protein binding; small GTPase binding; syntaxin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCA1 Products

Required fields are marked with *

My Review for All ABCA1 Products

Required fields are marked with *

0
cart-icon