"ABCA1" Related Products

Expand

Recombinant Human ABCA1 protein, GST-tagged

Cat.No.: ABCA1-178H
Product Overview: Recombinant Human ABCA1(86 a.a. - 185 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesteral efflux pump in the cellular lipid removal pathway. Mutations in this gene have been associated with Tangier's disease and familial high-density lipoprotein deficiency.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYH NLSLPKSTVDKMLRADVILHKVFLQ
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1 [ Homo sapiens ]
Official Symbol: ABCA1
Synonyms: ABCA1; ATP-binding cassette, sub-family A (ABC1), member 1; ABC1, HDLDT1; ATP-binding cassette sub-family A member 1; Tangier disease; TGD; membrane-bound; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein; ABC1; CERP; ABC-1; HDLDT1;
Gene ID: 19
mRNA Refseq: NM_005502
Protein Refseq: NP_005493
MIM:
UniProt ID: O95477
Chromosome Location: 9q31
Pathway: ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem;
Function: ATP binding; ATPase activity; anion transmembrane transporter activity; apolipoprotein A-I binding; apolipoprotein A-I receptor activity; apolipoprotein binding; cholesterol binding; cholesterol transporter activity; nucleotide binding; phospholipid binding; phospholipid transporter activity; protein binding; small GTPase binding; syntaxin binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.