Recombinant Human ABCA1 protein, GST-tagged

• Cat.No.: ABCA1-178H
• Product Overview: Recombinant Human ABCA1(86 a.a. - 185 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 86-185 a.a.
• Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesteral efflux pump in the cellular lipid removal pathway. Mutations in this gene have been associated with Tangier's disease and familial high-density lipoprotein deficiency.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYH NLSLPKSTVDKMLRADVILHKVFLQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1 [ Homo sapiens ]
• Official Symbol: ABCA1
• Synonyms: ABCA1; ATP-binding cassette, sub-family A (ABC1), member 1; ABC1, HDLDT1; ATP-binding cassette sub-family A member 1; Tangier disease; TGD; membrane-bound; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein; ABC1; CERP; ABC-1; HDLDT1
• Gene ID: 19
• mRNA Refseq: NM_005502
• Protein Refseq: NP_005493
• UniProt ID: O95477
• Chromosome Location: 9q31
• Pathway: ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem
• Function: ATP binding; ATPase activity; anion transmembrane transporter activity; apolipoprotein A-I binding; apolipoprotein A-I receptor activity; apolipoprotein binding; cholesterol binding; cholesterol transporter activity; nucleotide binding; phospholipid binding; phospholipid transporter activity; protein binding; small GTPase binding; syntaxin binding