Recombinant Human ABCA1 protein, His-tagged
| Cat.No. : | ABCA1-3140H |
| Product Overview : | Recombinant Human ABCA1 protein(106-305 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 106-305 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | FSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQELFSMRSWSDMRQEVMFLTNVNSSSSSTQIYQAVS |
| Gene Name | ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1 [ Homo sapiens ] |
| Official Symbol | ABCA1 |
| Synonyms | ABCA1; ATP-binding cassette, sub-family A (ABC1), member 1; ABC1, HDLDT1; ATP-binding cassette sub-family A member 1; Tangier disease; TGD; membrane-bound; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein; ABC1; CERP; ABC-1; HDLDT1; |
| Gene ID | 19 |
| mRNA Refseq | NM_005502 |
| Protein Refseq | NP_005493 |
| UniProt ID | O95477 |
| ◆ Recombinant Proteins | ||
| ACLY-9291H | Recombinant Human ACLY protein, GST-tagged | +Inquiry |
| ACLY-2292H | Recombinant Human ACLY protein, His-tagged | +Inquiry |
| ABCA1-3140H | Recombinant Human ABCA1 protein, His-tagged | +Inquiry |
| Acly-252M | Recombinant Mouse Acly Protein, MYC/DDK-tagged | +Inquiry |
| ACLY-916H | Recombinant Human ACLY Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACLY-022HKCL | Human ACLY Knockdown Cell Lysate | +Inquiry |
| ACLY-509HCL | Recombinant Human ACLY cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACLY Products
Required fields are marked with *
My Review for All ACLY Products
Required fields are marked with *
