Recombinant Human ABCB4 protein, GST-tagged

Cat.No. : ABCB4-301507H
Product Overview : Recombinant Human ABCB4 (628-706 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Val628-Thr706
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : VNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name ABCB4 ATP-binding cassette, sub-family B (MDR/TAP), member 4 [ Homo sapiens ]
Official Symbol ABCB4
Synonyms ABCB4; ATP-binding cassette, sub-family B (MDR/TAP), member 4; MDR3, PGY3; multidrug resistance protein 3; GBD1; MDR2; PFIC 3; P-glycoprotein 3; multiple drug resistance 3; ATP-binding cassette sub-family B member 4; P glycoprotein 3/multiple drug resistance 3; P-glycoprotein-3/multiple drug resistance-3; MDR3; PGY3; ABC21; MDR2/3; PFIC-3;
Gene ID 5244
mRNA Refseq NM_000443
Protein Refseq NP_000434
MIM 171060
UniProt ID P21439

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCB4 Products

Required fields are marked with *

My Review for All ABCB4 Products

Required fields are marked with *

0
cart-icon