Recombinant Human ABCB4 protein, GST-tagged
Cat.No. : | ABCB4-301507H |
Product Overview : | Recombinant Human ABCB4 (628-706 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Val628-Thr706 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | VNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ABCB4 ATP-binding cassette, sub-family B (MDR/TAP), member 4 [ Homo sapiens ] |
Official Symbol | ABCB4 |
Synonyms | ABCB4; ATP-binding cassette, sub-family B (MDR/TAP), member 4; MDR3, PGY3; multidrug resistance protein 3; GBD1; MDR2; PFIC 3; P-glycoprotein 3; multiple drug resistance 3; ATP-binding cassette sub-family B member 4; P glycoprotein 3/multiple drug resistance 3; P-glycoprotein-3/multiple drug resistance-3; MDR3; PGY3; ABC21; MDR2/3; PFIC-3; |
Gene ID | 5244 |
mRNA Refseq | NM_000443 |
Protein Refseq | NP_000434 |
MIM | 171060 |
UniProt ID | P21439 |
◆ Recombinant Proteins | ||
ABCB4-397R | Recombinant Rat ABCB4 Protein | +Inquiry |
ABCB4-189M | Recombinant Mouse ABCB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCB4-301507H | Recombinant Human ABCB4 protein, GST-tagged | +Inquiry |
ABCB4-1091M | Recombinant Mouse ABCB4 Protein | +Inquiry |
ABCB4-11H | Recombinant Human ABCB4 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB4 Products
Required fields are marked with *
My Review for All ABCB4 Products
Required fields are marked with *