Recombinant Human ABCB4 protein, GST-tagged

• Cat.No.: ABCB4-301507H
• Product Overview: Recombinant Human ABCB4 (628-706 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Val628-Thr706
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: VNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ABCB4 ATP-binding cassette, sub-family B (MDR/TAP), member 4 [ Homo sapiens ]
• Official Symbol: ABCB4
• Synonyms: ABCB4; ATP-binding cassette, sub-family B (MDR/TAP), member 4; MDR3, PGY3; multidrug resistance protein 3; GBD1; MDR2; PFIC 3; P-glycoprotein 3; multiple drug resistance 3; ATP-binding cassette sub-family B member 4; P glycoprotein 3/multiple drug resistance 3; P-glycoprotein-3/multiple drug resistance-3; MDR3; PGY3; ABC21; MDR2/3; PFIC-3
• Gene ID: 5244
• mRNA Refseq: NM_000443
• Protein Refseq: NP_000434
• MIM: 171060
• UniProt ID: P21439