Recombinant Human ABCB9 Protein, GST-Tagged

Cat.No. : ABCB9-041H
Product Overview : Human ABCB9 partial ORF ( NP_062571, 482 a.a. - 580 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This family member functions in the translocation of peptides from the cytosol into the lysosomal lumen. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specificities. [provided by RefSeq, Jul 2011]
Molecular Mass : 36.63 kDa
AA Sequence : FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCB9 ATP-binding cassette, sub-family B (MDR/TAP), member 9 [ Homo sapiens ]
Official Symbol ABCB9
Synonyms ABCB9; ATP-binding cassette, sub-family B (MDR/TAP), member 9; ATP-binding cassette sub-family B member 9; EST122234; TAP-like protein; ABC transporter 9 protein; TAPL; KIAA1520;
Gene ID 23457
mRNA Refseq NM_001243013
Protein Refseq NP_001229942
MIM 605453
UniProt ID Q9NP78

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCB9 Products

Required fields are marked with *

My Review for All ABCB9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon