Recombinant Human ABCB9 Protein, GST-Tagged
Cat.No. : | ABCB9-041H |
Product Overview : | Human ABCB9 partial ORF ( NP_062571, 482 a.a. - 580 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This family member functions in the translocation of peptides from the cytosol into the lysosomal lumen. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specificities. [provided by RefSeq, Jul 2011] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABCB9 ATP-binding cassette, sub-family B (MDR/TAP), member 9 [ Homo sapiens ] |
Official Symbol | ABCB9 |
Synonyms | ABCB9; ATP-binding cassette, sub-family B (MDR/TAP), member 9; ATP-binding cassette sub-family B member 9; EST122234; TAP-like protein; ABC transporter 9 protein; TAPL; KIAA1520; |
Gene ID | 23457 |
mRNA Refseq | NM_001243013 |
Protein Refseq | NP_001229942 |
MIM | 605453 |
UniProt ID | Q9NP78 |
◆ Recombinant Proteins | ||
ABCB9-041H | Recombinant Human ABCB9 Protein, GST-Tagged | +Inquiry |
ABCB9-9213H | Recombinant Human ABCB9, GST-tagged | +Inquiry |
ABCB9-8131H | Recombinant Human ABCB9 protein, His & T7-tagged | +Inquiry |
ABCB9-6737Z | Recombinant Zebrafish ABCB9 | +Inquiry |
ABCB9-7R | Recombinant Rhesus Macaque ABCB9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCB9-3HCL | Recombinant Human ABCB9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCB9 Products
Required fields are marked with *
My Review for All ABCB9 Products
Required fields are marked with *